SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003020 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003020
Domain Number 1 Region: 70-122
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000265
Family Gar1-like SnoRNP 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003020   Gene: ENSMICG00000003326   Transcript: ENSMICT00000003323
Sequence length 190
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4693:71978:80550:1 gene:ENSMICG00000003326 transcript:ENSMICT00000003323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFRGGGRGGFSRGGGGGGFNRGGGGTNNHFRGGGGGNFRGGGGRGGFGRGGGRGGFNKG
QDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLR
DFXXXXXXXXXXXXXXXXXXXXFYIDPYKLLPLQRFLPRPPGEKAPPRGGGRGGGRGGGR
GGVGRGGGRG
Download sequence
Identical sequences ENSMICP00000003020 ENSMICP00000003020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]