SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003146 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003146
Domain Number 1 Region: 232-471
Classification Level Classification E-value
Superfamily Sema domain 1.44e-48
Family Sema domain 0.0025
Further Details:      
 
Domain Number 2 Region: 1344-1467,1665-1816
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-36
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 3 Region: 826-921
Classification Level Classification E-value
Superfamily E set domains 0.00000000000042
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 4 Region: 918-1001
Classification Level Classification E-value
Superfamily E set domains 0.0000000000364
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 5 Region: 474-527
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000549
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000003146
Domain Number - Region: 1001-1037,1075-1128
Classification Level Classification E-value
Superfamily E set domains 0.0448
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.052
Further Details:      
 
Domain Number - Region: 628-658
Classification Level Classification E-value
Superfamily Plexin repeat 0.061
Family Plexin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003146   Gene: ENSMICG00000003449   Transcript: ENSMICT00000003457
Sequence length 1880
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2257:90821:115530:1 gene:ENSMICG00000003449 transcript:ENSMICT00000003457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHTAWDIPLLHPFMVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSYVGAFT
DAGSAYFVFHHRGAQAQTEYHSYVARVCLGDANLYSYVEVPITCRGQGLIQASFLAPGTL
LGLFAAGPRGTQAALCAFPLAELDRSMERARQLCYTAGGRGPSGTEEATVEYGVTSRCVT
LPLDSPGAYPCGDEHTPSPIAGRQPLEAPLLQLEQPISAIAALQADGHTIAFLGDAQGQL
HKVFLNGSQGQVYHSQQVGPPGSPISPDLLVDSGGIHLYVLTVQQVDRVTVAACPQFPDC
ISCLRAQDPLCGWCVLQGRCTRKCQCVRVGQPNQWLWSYEDTHCLCIQNLLPAHRPRQEQ
DQVTLSVPQLPTLAVDEYFHCAFGDYESLAHVEGPHVSCVTPPQDQVPLNPPGTDHVTVP
LALMFEDVFVAAANFSFYYCNAIQALEVAAPCHACVGSLWRCHWCPQSGHCVYRKHCPED
GRTVYSAQEVDVQVRGPACPQVEGLAGPHLVPVGWESHLALMNLHRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLIHCQAQQFWPSVSRRELQVPIYVTRGETQRLDDAHNLHVTLY
DCAVGHPDCSHCQAANRSLGCLWCSDGQPACRYGPLCAPGAVQLLCPMPSIDVIEPLTSP
PEGGLAVTILGSNLGQAFADVWDAVSVAGQPCSPDPDLYRTSARIVCVTSPAPSGTTGPV
QVAIKSRPPGISSQHFTYQDPVLLSLSPQWGTQLTIHGQHLQTGGNVSAFVGGQPCPIQE
PVCPEAIVCRTMPQAAPGEAVVLVVFGHAQCTLLTSPFHYTVNPQLVAAEPSTSFRRGTG
LDVVQRPLLSVWLEAVKEVQASGIQPQGPNLRRSCGAPAVDTQACIELGGGLLQCSTVCS
INSSSLLLCQSPAVPDSARPQRVFFALDNMHVDFTSASGGQRFLYQPNPRLAPLSRPYRL
KPGHVLDVEGEGLTLGSSKEEVRAHIGMGECLVKTLTFTHLYCQPPLRAPPPEGPDALPQ
FVVQMGHVRLALGPVQYEAEPTSPTFPVEAQTGLARGAAVLVAAVLLLTLVYRHKSEQAL
QDYQKVLVQLESLETGVGDQCCKEFTDLMTEMIDLSSELEASGIPFLDYQVYTEHAFFPG
HGGCLLQPTPEGPGEEGHRQGLMQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHVASLL
SLALHGKLEYLTDIMKTLLGDLAAHYVHKNPKLMLCRMETMVEKLLSNWLSICLYAFLRE
VVGEPLYMLFWAIQYQVDKGPVDAVTGKAKRTLNDSRLLWEDVEFWSLTLMVLVGPGAGG
AAGGSEAQRVPAQVLDTDITQVKEKVLGQVYKGTPFSQRPSVHAVDLXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVPDGATVGLIPQLHDGSTISQNQAHSCPLGENIPMLED
GEEGRVRLWHLVKATEEPEGAKVWRSSLQEREWTRAKAIPEIYLTCLLSMKGTLQKFVDD
TFQAIFSVNRPVPIAIKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFWVNALKNPQL
IFDVRVSDNVDAILAIIAQTFIDSCTVSEHKVGRDSPVNKLLYTQEIPRYKQMIEKYYAD
IRQSSPASYQKMNSALAELSENYTFASHCLEALQGLYNHIHRYYDQIISALEDEPLGQKV
QLACRLQHIAALVENKVTDL
Download sequence
Identical sequences ENSMICP00000003146 ENSMICP00000003146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]