SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003254 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003254
Domain Number 1 Region: 82-261
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.37e-63
Family Brix domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003254   Gene: ENSMICG00000003577   Transcript: ENSMICT00000003575
Sequence length 291
Comment pep:novel genescaffold:micMur1:GeneScaffold_4862:1276:5523:1 gene:ENSMICG00000003577 transcript:ENSMICT00000003575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHE
VGALVRACKANGVTDLLVIHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPNLGTIS
EAKPHLITHGFSSRLGKRVSDILRYLFPVPKDDSHRVITFANQDDYISFRHHVYKKIDRR
NVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVFLSAE
Download sequence
Identical sequences ENSMICP00000003254 ENSMICP00000003254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]