SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003371 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003371
Domain Number 1 Region: 142-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.54e-101
Family Transglutaminase core 0.000000000604
Further Details:      
 
Domain Number 2 Region: 480-592
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.03e-29
Family Transglutaminase, two C-terminal domains 0.00000336
Further Details:      
 
Domain Number 3 Region: 4-139
Classification Level Classification E-value
Superfamily E set domains 3.5e-28
Family Transglutaminase N-terminal domain 0.0000534
Further Details:      
 
Domain Number 4 Region: 594-692
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-27
Family Transglutaminase, two C-terminal domains 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003371   Gene: ENSMICG00000003703   Transcript: ENSMICT00000003701
Sequence length 693
Comment pep:known_by_projection scaffold:micMur1:scaffold_2570:96898:138874:1 gene:ENSMICG00000003703 transcript:ENSMICT00000003701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLEPQHINWQVSSNRQAHHTDQFSSQELIVRRGQPFQIVLTVSRSLNSRDRLEFTVTT
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLPIAISSPASAPIGRYELSLQIFSQ
AGNASVKLGEFILLFNPWVNVDSVFLSNHAERQEYVQEDAGVIYVGSTNRINMIGWNFGQ
YEEDILSTCLSILDRSLNYRRDPANDVAHRNDPKYVGRVLSAMXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFSSA
HDTDRNLSVDVYYDPMGNPLDKGSDSVWNFHVWNEAWFTRSDLGPSFNGWQVLDATPQER
SQGVFQCGPCSVHAVREGDVKLEFDTPFVFAEVNADRINWIQDVSTGKEKKNSVDTRSVG
RYISTKAVGSYSRMDVTEKYKYPEGSSQERQVFEKAMGQLKPSASFGPTSAGRSEAEEQE
PSISGRFKVTGILAVGKEVSLVLLLQNLTSEEKSVKVNMTAWTIVYNGTLVHEVWKDSVS
MSLGPDEEALHPVKISYAQYQNYLKADNMIRITAVCKVPGEAEVVVERDVILDNPTLTLE
VLEEAHVRKPMTVQMLFSNPLDEPVKNCVLMVEGSGLLLGNLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
Download sequence
Identical sequences ENSMICP00000003371 ENSMICP00000003371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]