SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003404 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003404
Domain Number 1 Region: 187-288
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003404   Gene: ENSMICG00000003737   Transcript: ENSMICT00000003736
Sequence length 289
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4788:543:5204:-1 gene:ENSMICG00000003737 transcript:ENSMICT00000003736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THKEAEMPIGPQRDEKGRWWRPGDGSIAPPPLPPALSFLLLLPLXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXEGSVRLVGGANPCQGRVEILHGGLWGTVCDDDWGLPDATVVCRQLGCGVALAATT
NAFFGYGTGHILLDNVHCEGGEPHLAACLSLGWGVHNCGHHEDAGVLCA
Download sequence
Identical sequences ENSMICP00000003404 ENSMICP00000003404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]