SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003442 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003442
Domain Number 1 Region: 607-881
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.98e-107
Family PDEase 0.000000174
Further Details:      
 
Domain Number 2 Region: 500-583
Classification Level Classification E-value
Superfamily GAF domain-like 7.57e-23
Family GAF domain 0.00059
Further Details:      
 
Domain Number 3 Region: 198-312
Classification Level Classification E-value
Superfamily GAF domain-like 3.05e-17
Family GAF domain 0.0023
Further Details:      
 
Domain Number 4 Region: 364-437
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000013
Family GAF domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003442   Gene: ENSMICG00000003770   Transcript: ENSMICT00000003776
Sequence length 881
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4801:287837:620929:-1 gene:ENSMICG00000003770 transcript:ENSMICT00000003776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALRRELLGEVETFLDRHPELFEDYLMKGKQEMVKCLQRNSQGRGVLSPGPASAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXPLSSVRRRALLRKASSLPPTTAHILSALLESRVN
LPQYPTTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSLF
LVEGAAAGKKSLVSKFFDVHAGTPLLPSSSTENSNEVQVPWGKGIIGYVGEHGETVNIPD
AYQDRRFNDEIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMQM
YLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCE
RCSVLLLEDIESPVVKFTKSFELMSPKCSADAENXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXVEQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDD
ADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANIP
LVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRMV
LYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSGS
ALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLYF
ERRTEFFELVSKGECDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQASELVTSEFFEQ
GDRERSELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQ
Download sequence
Identical sequences ENSMICP00000003442 ENSMICP00000003442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]