SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003461 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003461
Domain Number 1 Region: 18-96
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000000000000889
Family BAR domain 0.047
Further Details:      
 
Domain Number 2 Region: 400-472
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000235
Family BCR-homology GTPase activation domain (BH-domain) 0.0021
Further Details:      
 
Domain Number 3 Region: 271-345
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000844
Family BCR-homology GTPase activation domain (BH-domain) 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003461   Gene: ENSMICG00000003781   Transcript: ENSMICT00000003797
Sequence length 689
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_697:116047:128169:1 gene:ENSMICG00000003781 transcript:ENSMICT00000003797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRQLHRMRQLAQTGSLGRTPETAEFLGEDLLQVEQRLEPAKRAAHNVHKRLQACLQGQ
SGADMDKRVKKLPLMALSTTMAESFKELDPDSSMGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXTSPSMAAASTSRMYGVSLGTHLQELGRDIALPIEACVMML
LSEGMKEEGLFRLAAGASVLKRLKQTMASNPHSLEEFCSDPHAVAXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYLMKFLAQLAEEQEVNKMTP
SNIAIVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQSADSLFPGDINFNVSGL
FSALAPQDTVSDQLASDALPAIAVPTPVPAPAPAPAPAPAPATKERTESEAPPRPSSPKV
NRSPPETAAPVDDTARRTKRPAPARPNMPPPQLSSTRASAPAPPPPPGSGSPGTPRALPR
RLVGSNLRAPTVPPPLPPMAPQPARRQSRRSPAPLSPASPSPVSSSTPAQVDLGVPTEGG
EAPEPAGGFPASPATPPQPQPRSLASETD
Download sequence
Identical sequences ENSMICP00000003461 ENSMICP00000003461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]