SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Microcebus murinus 76_1 > ENSMICP00000003492

Domain assignment for ENSMICP00000003492 from Microcebus murinus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMICP00000003492
Domain Number 1	Region: 10-120,161-187
Classification Level	Classification	E-value
Superfamily	SH2 domain	2.56e-26
Family	SH2 domain	0.00000243
Further Details:

Domain Number 2	Region: 62-79,135-227
Classification Level	Classification	E-value
Superfamily	SH3-domain	1.55e-25
Family	SH3-domain	0.0000291
Further Details:

Domain Number 3	Region: 224-298
Classification Level	Classification	E-value
Superfamily	SH3-domain	0.00000016
Family	SH3-domain	0.0032
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMICP00000003492 Gene: ENSMICG00000003835 Transcript: ENSMICT00000003830
Sequence length	302
Comment	pep:known_by_projection genescaffold:micMur1:GeneScaffold_3342:95398:215625:-1 gene:ENSMICG00000003835 transcript:ENSMICT00000003830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAGNFDSEERSSWYWGRLSRQEAVVLLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY IINSSGPRPPVPPSPAQPPPAVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG MIPVPYVEKYRPASASVSAVIGGNQEGSHLQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA RVIQKRVPNAYDKTALALEVELKVTKINVSGQWEGECDGKRGHFPFTHVRLLDQQNPDEG FS
Download sequence
Identical sequences	ENSMICP00000003492 ENSMICP00000003492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]