SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003850 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003850
Domain Number 1 Region: 231-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.33e-38
Family Laminin G-like module 0.0000000282
Further Details:      
 
Domain Number 2 Region: 462-668
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.77e-33
Family Laminin G-like module 0.0000000215
Further Details:      
 
Domain Number 3 Region: 19-75
Classification Level Classification E-value
Superfamily GLA-domain 1.21e-19
Family GLA-domain 0.00071
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000003850
Domain Number - Region: 209-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003850   Gene: ENSMICG00000004215   Transcript: ENSMICT00000004223
Sequence length 673
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4009:4235:34590:1 gene:ENSMICG00000004215 transcript:ENSMICT00000004223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLRAREAAQFLRPRQRRAFQLFEEAKQGHLERECVEELCSKEEAREVFENDPETEYFYP
RYLECINKHGSPYSKNPDFAACVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVDECAQGRCEQACVNTPGSYSCHCDGRGGLKL
SPDMDTCECKVGPRSPGLGRTGVGRGRGPSRPQDILPCVPFSVAKSVKSLYLGRMFSGTP
VIRLRFKRLQPTRLVAEFDFRTFDPEGVLFFAGGRQDSTWIVLALRAGRLELQLRYNGVG
RVTSSGPIINHGTWQTISVEELERNVVVKVNKDAVMKIAVAGDLFQRDRGLYHLNLTVGG
IPFKEKDLVQPINPRLDGCLRSWNWLNGEDSAIQETVRANARMQCFSATERGSFYPGNGF
AFYSLDYARTSPDVGTETTWEIRVVARIRPATDTGVLLALWAPDHRVVPLSVALVDYHSS
KKLKKQLVVLAVESVALALVEIKACDGQEHVVSVSLREGTAALEVDGTRGWSEVGAVQLR
ERLDTLGRHLRGPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNGRALDLDEAAYKHSDI
SSHSCPPAEPGTR
Download sequence
Identical sequences ENSMICP00000003850 ENSMICP00000003850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]