SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003936 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003936
Domain Number 1 Region: 5-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-17
Family Clostridium neurotoxins, the second last domain 0.048
Further Details:      
 
Domain Number 2 Region: 222-346,410-478
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000000269
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 356-519
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000127
Family Reprolysin-like 0.076
Further Details:      
 
Domain Number 4 Region: 1271-1334
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000556
Family Complement control module/SCR domain 0.0053
Further Details:      
 
Domain Number 5 Region: 1207-1279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000334
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 6 Region: 1146-1211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000278
Family Complement control module/SCR domain 0.0041
Further Details:      
 
Domain Number 7 Region: 1076-1149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000445
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000003936
Domain Number - Region: 745-802
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00213
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number - Region: 1415-1444
Classification Level Classification E-value
Superfamily Notch domain 0.0418
Family Notch domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003936   Gene: ENSMICG00000004317   Transcript: ENSMICT00000004318
Sequence length 1453
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3988:198895:398255:1 gene:ENSMICG00000004317 transcript:ENSMICT00000004318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYDKCSYTSRDRGWVVGIHTVGDQGNRDPRYFFSLKTDRARQVTTINAHRSYLPGQWVYL
AATYDGHFMKLYVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYRGYIERFSLW
KVARTQREILSDMDTHGLHPPLPQLLLQENWDNVKRTWSPMKDGNSPRVESSTAHGFLLD
TSLEPPLCGQTLCDNTEVIASYNQLPSFRRPKAVRYRVVNLYDDSHENPTVSRQQVDFQH
RQLAEAFKHYNISWELEVLEVSNSSLRHRLILANCDISKIGDENCDPECNHTLTGHDGGD
CRHLRHPAFMKKQQNGVCDMDCNYERFNFDGGECCDPEITDVTKTCFDPDSPHRAYLDVN
ELKNILRLDGSTHLNIFFANSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGIPGHTHT
MIHEIGHSLGLYHIFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKFCGDPGPGN
DTCGFHSFFNTPYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYRSWQPSRKPAPVALAP
QVVGHTADSVMLEWFPPIDGHFFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXHPDVEQPCKSSVRTWSPNSAVNPHTVPPACPEPQGCYLELEFLYPLVPESLTVW
VTFVSTDWDSSGAVNDIKLLTVSGKNVSLGPQNVFCDVPLTIRLRDVGEEVYGVQIYTLD
EHLEIDAAMLTSTADSPLCLECKPLQYKVVRDPPLQAEVASILRLNRRFVDTNLSLGSVY
QYRVITISGTEESEPSPAAVYTHGSGYCGDGIIQKSQGEECDDMNKINGDGCSLFCRQEI
SFNCIEEPSRCYFHDGDGVCEEFERKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGW
VIIGQPAASQVCRTKVIDLSEGLSQHAWYPCTISYPYSQLAQTTFWLRAYFSQPMVAAAV
IVHLVTDGTYYGDQKQETISVQLFDTKDHSHDLGVHVLSCRNNPLIIPVVHDLSQPFYHS
QAVRVSFSSPLVAISGVALRSFDNFDPVTLSSCQRGETYSPAEQSCVHFACEATDCPELA
VENASLNCSSSDRYHGAQCTVSCRTGYVLQIQRDDELIKSQTGPSITVTCAEGKWNKQVA
CEPVDCGVPDHHHVYAASFSCPEGTTFGSTCSFQCRHPAQLKGNNSLLACMEDGLWSFPE
ALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQC
TQDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFSSECRIKCEDSDASQGRGSNVIHCR
KDGTWSGTFHLCQEMQGQCSAPNQLNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMN
VTVRDIPHWLNPTRVERVVCTAGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYD
GGDCCTSTVKTKK
Download sequence
Identical sequences ENSMICP00000003936 ENSMICP00000003936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]