SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003969 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003969
Domain Number 1 Region: 162-265
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.29e-44
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000392
Further Details:      
 
Domain Number 2 Region: 67-196
Classification Level Classification E-value
Superfamily Translation proteins 5.2e-35
Family Elongation factors 0.00000543
Further Details:      
 
Domain Number 3 Region: 3-85
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000052
Family G proteins 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003969   Gene: ENSMICG00000004360   Transcript: ENSMICT00000004354
Sequence length 286
Comment pep:novel scaffold:micMur1:scaffold_27703:9316:10178:-1 gene:ENSMICG00000004360 transcript:ENSMICT00000004354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYIKKGYNPDTVAFVPISGWDSDNMLEPSANMPWFKGWKVTHKDGNTSGTTLLEALDCIL
PPTRPTDKPLRLPLQDAYKIGGIGTVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHH
EALSEALPGDNVGFNVKKVSVKDVRRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAG
YAPVLDCHTAHIACKFAELKEKIDCRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVNSFS
DYPPLGCFAVRDMRQTVAVGVIKAVDKKAAGAGKVTESAQKAQKAK
Download sequence
Identical sequences ENSMICP00000003969 ENSMICP00000003969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]