SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004210 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004210
Domain Number 1 Region: 190-292
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 6.99e-43
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 95-224
Classification Level Classification E-value
Superfamily Translation proteins 6.03e-36
Family Elongation factors 0.00000468
Further Details:      
 
Domain Number 3 Region: 1-113
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.6e-17
Family G proteins 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004210   Gene: ENSMICG00000004624   Transcript: ENSMICT00000004619
Sequence length 313
Comment pep:novel scaffold:micMur1:scaffold_8437:16381:17322:-1 gene:ENSMICG00000004624 transcript:ENSMICT00000004619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVGVNKMDSTEPPYSQKRYEEIVKEVSTYIKKIGYNPNTVAFVPISGWNGDNMLEPSANM
PWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVE
TGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDVRRGNVAGD
SKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKIDRRSGKKLE
DGPKFLKSGDAAIVDMVPGKPMCVESFSDYPLGRFAVRDMRQTVAVGVIKAVDKKAAGAG
KVTKSAQKAQKAK
Download sequence
Identical sequences ENSMICP00000004210 ENSMICP00000004210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]