SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004564 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004564
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.27e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 59-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 730-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000868
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 10 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000041
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004564   Gene: ENSMICG00000005012   Transcript: ENSMICT00000005007
Sequence length 792
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3312:4843:73791:-1 gene:ENSMICG00000005012 transcript:ENSMICT00000005007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAINPWASWGALMDQSWRMAAVDPWASWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE
PVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQITKPEVISLLEQGEEP
WSVEQAYPQSTCPEWVRNLESKALIPTQSIFEEEQSHGMKLERYIWNDPWFSRLEVLGCK
DQLEMYHMNQSTAMRQMVFMEKQVLSQRSSEFSELGAECSQNVNFVPSQGVSQIEHFYKP
DTHAENWRCNSAIMYADNITCENNDYDKAFYQSVKPIDPIGVQTRDNLFRCTDAVKSFNH
IIHFGDHKGMHTGEKLYEYKECHQIFNQSPSFNEHPRLHIGGNQYDYKEYENIFYFSSFM
EHQKIGTVEKTYKCNEWEKVFGYDSFLTQHTSAYTAEKPCEYNECGTSFIWSSYLIQHKK
THTGEKPYECEKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPF
KCDECEKAFRDYSALTKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQE
CGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKS
FSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNES
SSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNECGKAFSGHSALL
QHQRNHNEEKLN
Download sequence
Identical sequences ENSMICP00000004564 ENSMICP00000004564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]