SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004604 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004604
Domain Number 1 Region: 173-389
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.45e-29
Family G proteins 0.0059
Further Details:      
 
Domain Number 2 Region: 500-588
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 8.63e-16
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 414-496
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000283
Family Elongation factors 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004604   Gene: ENSMICG00000005049   Transcript: ENSMICT00000005049
Sequence length 602
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1582:210326:217433:-1 gene:ENSMICG00000005049 transcript:ENSMICT00000005049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSRVSELFGGCCRPGGGPAVGGILKARGAGGSSGCGGPKGKKKNGRNRGGKANNPPYLP
PEAEDGNIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEM
RASLKTLHRMAEKVGADITVLREREVDYDSDTPRKITEVLVRKVPDNQQFLDLRVAVLGN
VDSGKSTLLGVLTQGELDNGRGRARLNLFRHLHEIQSGRTSSISFEILGFNSKGEVVNYS
DSRTAEEICESSSKMITFIDLAGHHKYLHTTIFGLTSYCPDCALLLVSANTGIAGTTREH
LGLALALKVPFFIVVSKVDLCAKTTVERTVRQLERVLKQPGCHKVPMLVTSEDDAVTAAQ
QFAQSPNVTPIFTLSSVSGESLDLLKVFLNILPPLTNSKEQEELMQQLTEFQXXXIYTVP
EVGTVVGGTLSSGICREGDQLVVGPTDDGCFLELRVCSIQRNRSACRVLRAGQAATLALG
DFDRALLRKGMVMVSPEMNPTICSVFEAEIVLLFHATTFRRGFQVTVHVGNVRQTAVVEK
IHAKDKLRTGEKAVVRFRFLKHPEYLKVGAKLLFREGVTKGIGHVTDVQAITAGEAQANM
GF
Download sequence
Identical sequences ENSMICP00000004604 ENSMICP00000004604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]