SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004616 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004616
Domain Number 1 Region: 61-129
Classification Level Classification E-value
Superfamily Ribosomal protein S18 6.41e-19
Family Ribosomal protein S18 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004616   Gene: ENSMICG00000005062   Transcript: ENSMICT00000005061
Sequence length 259
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1582:257969:275258:-1 gene:ENSMICG00000005062 transcript:ENSMICT00000005061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFKTLVSGCGWLLRGLLAGPGTANWARLPARGFREVVEIQEGKTTIIEGRITESPRES
PNPPNPSGQCPICRWNLKHKYDYVDVLLLSQFIRPNGGMLPRKITGLCQEEHRKIEECVK
MAHRAGRGPSGLRGGKPSLPTQLPHVPAPPRREVDMQSVNYTHLILNPLPLAFSLASELQ
RPFLLPHSGLLPNHRPRLPEGFVPKSKPQLNRYLTRWSPHSVKPIYNKGHRWNKVGMPVG
SPLLKDNIRYSPTPLKYYH
Download sequence
Identical sequences ENSMICP00000004616 ENSMICP00000004616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]