SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004684 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004684
Domain Number 1 Region: 22-60,139-200
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.46e-18
Family Phosphoribulokinase/pantothenate kinase 0.084
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000004684
Domain Number - Region: 20-99,221-283
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.086
Family Phosphoribulokinase/pantothenate kinase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004684   Gene: ENSMICG00000005140   Transcript: ENSMICT00000005138
Sequence length 350
Comment pep:known_by_projection scaffold:micMur1:scaffold_17346:35416:43081:1 gene:ENSMICG00000005140 transcript:ENSMICT00000005138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTADSARGAGSEGPRKLALCVLCGLPAAGKSTFARALGQRLRLEQGWAVGVVAYDDVIP
EAFLDGADARPPPSQWKLLRQELLRYLEYFLMAVVSGCQMSAPPKRTEAMWEDFITCLKD
QDLIFSAAFEAQSCYLLMKTALSRPLLLILDDNFYYQSMRYEVYQLARKYSLGFCQLFLD
CPLETCLQRNGQRPRALPAETIHLMGRKIEKPNPEKNAWEHNSLTIQSPACASEASLEVT
DLLRIALENPVKYVEDNVEQKETDRMICSTNILHKVDQTLRRIVSQTMKEAKGNQEHFSE
MTFKQRHEREGANHVVIWRIILGSGHIKCKTPEVELEHSRTGKRSLSMGG
Download sequence
Identical sequences ENSMICP00000004684 ENSMICP00000004684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]