SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004833 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004833
Domain Number 1 Region: 39-138
Classification Level Classification E-value
Superfamily PH domain-like 9.47e-36
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000002
Further Details:      
 
Domain Number 2 Region: 382-451
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000000275
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004833   Gene: ENSMICG00000005299   Transcript: ENSMICT00000005303
Sequence length 505
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2458:72008:144570:-1 gene:ENSMICG00000005299 transcript:ENSMICT00000005303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTMSSAVVQLFAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLCRRQRKSXXXXXXXXXPNLPMATVDIKNPEITTNRFYSPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPPPSRGGPPPPPPPPHSSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPGGGVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPPLSVAGSVAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTPAGSKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences ENSMICP00000004833 ENSMICP00000004833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]