SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004875 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004875
Domain Number 1 Region: 547-940
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.77e-120
Family alpha-mannosidase, C-terminal domain 0.0000000000948
Further Details:      
 
Domain Number 2 Region: 52-278
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.15e-69
Family alpha-mannosidase 0.0000000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004875   Gene: ENSMICG00000005342   Transcript: ENSMICT00000005349
Sequence length 946
Comment pep:novel genescaffold:micMur1:GeneScaffold_908:10461:57680:-1 gene:ENSMICG00000005342 transcript:ENSMICT00000005349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTVARALLVRSGGCPRAARPWTSSRALRPPLPPLPCLFLVLLAAPGARAAGYETCHPVQ
PDMLNVHLVAHTHDDVGWLKTVDQYYYGTRELYQQGAVQYILDSVISALQEDPTRRFIYV
EMAFFSRWWNQQTNVTQEIVRELVGQMGFDGFFLGRLDYQDKMQRELTEEMEQLWRASAS
LRPPIADLFTGVLPNIYEPPKGLCWDEMCSDEPIVEDPNSSEYNANHVVRHFLDVANSQS
QHYRTNHIVMTMGSDFQYENAHMWFKNLDKLIQLVNAKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXFIRATFHPKTGLLMQIENLEKNLLLPVQQGFYWYNASVGDNRSSQTSGAYIFRP
TRQQPLPVSRWARTQVVKTALVQEVHQNFSAWCSQVVRLYPGQRHLELEWTVGPIPVTDS
WGKEVISRFDTLLETGEVFYTDSNGREILERRRDYRPTWTLEQTEPVAGNYYPVNTRIYI
TDGQVQLTVLTDRSQGGSSLQKGSLELMVHRKLVRDDGRGVDEPLMELGSGAWVRGRHFV
LLDTVKTAAAGHRLLAEKVVLAPQVVLSQGDSVLYNLWASPRKQFSGLRWELPPSVHLLT
LASWGPGVLLLRFEHQFAINEDSLRNLSSPVTLDLRDMFSTFTITRLQETTLAANQPRAT
ASRLKWRPNTGPSPRSTPYVLDPAAVTLQPMEIRTFLATVKWKKNN
Download sequence
Identical sequences ENSMICP00000004875 ENSMICP00000004875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]