SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004902 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004902
Domain Number 1 Region: 222-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-26
Family D-aminoacid oxidase-like 0.0029
Further Details:      
 
Domain Number 2 Region: 8-67,147-336
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-21
Family FAD-linked reductases, N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004902   Gene: ENSMICG00000005380   Transcript: ENSMICT00000005377
Sequence length 390
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2942:301702:314639:1 gene:ENSMICG00000005380 transcript:ENSMICT00000005377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALKDLCDAIVIGAGIQGCFTAYHLARHRKKVLLLEQFFLPHSRGSSHGQSRIIRKAYA
EDFYTRMMDECYRIWAQLEQEAGTPLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDAVRRLGGDVRDGEKVTEIKP
GLPVVVKTASRSYQAKSLIITAGPWTNWLLRPLGIELPLQTLRINVCYWREKVPGSYSAS
QAFPCFLGLGQAAHHIYGLPAGEYPGLMKVCYHHGNRADPDERDCPEARSDSQDVQVLCR
FVKNHLPGLKPEPAVMEHCMYTNTPDKHFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLTPSYDLTPFRISRFPGLGKAHL
Download sequence
Identical sequences ENSMICP00000004902 ENSMICP00000004902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]