SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004940 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004940
Domain Number 1 Region: 345-447
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000004940
Domain Number - Region: 109-191
Classification Level Classification E-value
Superfamily t-snare proteins 0.00337
Family t-snare proteins 0.015
Further Details:      
 
Domain Number - Region: 172-268
Classification Level Classification E-value
Superfamily STAT 0.00471
Family STAT 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004940   Gene: ENSMICG00000005424   Transcript: ENSMICT00000005419
Sequence length 448
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_179:14911:78137:-1 gene:ENSMICG00000005424 transcript:ENSMICT00000005419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQWNRFQDQQEDNDSCTESVKFDAHSMTALLPLNPKNGPTLQEKLKSFKAALIALYLLV
FAVLIPIIGIVAAQLLKWEVKNCTVGSVYENGISQSLTGKGNGSEEAARFQEVVMEHISN
MERRIQHISDTEANLIDSERFQNFSVTTDQRFSDVLFKLSTLVSSVQERGNEIDEIFKSL
ISLNTTLLDLQLKIERLDGKIQDNTIKQQKEISKLEERVYNASAEIMSIKEEQVHLEQEI
KGEVKVLNNITNDLRLKDWEHSQTLRNISLLQGPPGPPGEKGDRGAPGESGPQGIPGPIG
PPGLKGDRGAIGFPGSRGFPGSTGRPGQKGQKGEKGSGNTSTLSRTVRLVGGGGPHEGRV
EIFHNGQWGTICDDRWELRVGLVICRSLGYQGVQSVHKAAHFGQGTGPIWLNEVFCFGRE
SSIEQCKIRQWGVRACTHSEDAGVTCTL
Download sequence
Identical sequences ENSMICP00000004940 ENSMICP00000004940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]