SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000004990 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000004990
Domain Number 1 Region: 113-306
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.54e-29
Family Phospholipase D 0.024
Further Details:      
 
Domain Number 2 Region: 4-81
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.28e-19
Family Nuclease 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000004990   Gene: ENSMICG00000005479   Transcript: ENSMICT00000005476
Sequence length 321
Comment pep:known_by_projection scaffold:micMur1:scaffold_8293:3174:6118:1 gene:ENSMICG00000005479 transcript:ENSMICT00000005476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STDLQALAAQGAQVRQVPMGHLTRGVLHSKFWVVDGRHVYLGSANMDWRSLTQVKELGTI
IYNCSHLARDLEKTFQTYWVLGAPQAVLPKTWPQNFSSHINLAQPFQGLFDGVPTTAYFS
ASPPVLCPRGRTRDLDALLAVMGAAQEFIYASVMEYFPTTRFARPARYWPALDDALRAAA
FSRGVRVRLLVSCWLHTDPAMFPFLRSLQALSNPAANISVDVKVFIVPVGNHSNIPFSRV
NHSKFMVTERAAYIGTSNWSEDYFSSTSGVGLVVNQTAPCARLGVATVQEQLRQLFERDW
SSRYAVGLDGQAPGQDCVWRS
Download sequence
Identical sequences ENSMICP00000004990 ENSMICP00000004990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]