SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005034 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005034
Domain Number 1 Region: 484-686,727-808
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.41e-51
Family PDEase 0.0000357
Further Details:      
 
Domain Number 2 Region: 55-251
Classification Level Classification E-value
Superfamily GAF domain-like 1.57e-30
Family GAF domain 0.00042
Further Details:      
 
Domain Number 3 Region: 375-458
Classification Level Classification E-value
Superfamily GAF domain-like 3.92e-17
Family GAF domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005034
Domain Number - Region: 237-289
Classification Level Classification E-value
Superfamily GAF domain-like 0.00785
Family GAF domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005034   Gene: ENSMICG00000005511   Transcript: ENSMICT00000005522
Sequence length 853
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2104:309612:352019:1 gene:ENSMICG00000005511 transcript:ENSMICT00000005522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDVSRDAVEKYLEENPRFAKEYFDRKLRAEVLGEIFKNSQVSVQASVSFLELTQVEESA
LCLELLQMVQEEAGGPEPAVHRALQRLAQLLQADRCSLFLCRARNGTPEVASRLLNVTPT
SKFEDNLVAPDREVVFPLDIGIVGWVAHTKKPLNVPDVKKNNHFSDFMDKQTGYVTKNLL
ATPIVMKEVLAVVMAITKVNAPEFSKHDEEVFSKYLNFVAVVLKLHHTSYLYSIESRRSQ
ILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKFYDDAIKLGEAEP
YKGPKTPDGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEHIME
VTTLTQFLGWSLLNTDTYEKMNKLENRKDIAQEMLMNQTKATPDEVKSILKFKEKLNIDI
IEDCEEKQLVTILKEDLPDPKATELYEFRFSDFPLTEHGLIKCGLRLFFEINVVEFKVPE
XXXXXXXXXXXXXXXXXXXXXXHGFNVQTMFTLLMTGRLKKYYTDLEAFAMLAAAFCHDI
DHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQYETVIHL
FEVAIIATDLALYFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXVALLVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQFIFVCTFV
YEFSRFHKEIKPMLNGLQNNRVEWKTLADEYDAKMKVIEEEVKKQEEGNMIQKAAEDSGG
GGDDKKSKTCLML
Download sequence
Identical sequences ENSMICP00000005034 ENSMICP00000005034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]