SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005091 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000005091
Domain Number - Region: 131-170
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0689
Family AmyC N-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005091   Gene: ENSMICG00000005584   Transcript: ENSMICT00000005582
Sequence length 316
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3384:8392:15332:-1 gene:ENSMICG00000005584 transcript:ENSMICT00000005582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGLGTERGEPLRPPLLCNQKTESLTLLIQVPRIQPQSLQGDLSPHWYKLRFSTQDLVYS
FFLQFAPENKLSTKEPEISISSNNAVIELAKSPESHGLWREWYYGLNXXXXXERLFVNEE
NVNEFLEEVLSSPFKQTMSLSPPLIEVLQVTDNKIQITAKLQECSNSDQLQGKEERVSEG
SHLTEKENIEHFTTSTTDSDCGSVACFQQKSLDDSQMLFGKSQQPESKMEPEFIKEKSAT
YANMEKDNLNEPVISEEKELDGDHLSSLLNKTTVHNIPDFDSIKETNMEDGSVQIIKDHV
THCAFRFQNSLLYDLD
Download sequence
Identical sequences ENSMICP00000005091 ENSMICP00000005091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]