SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005108 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005108
Domain Number 1 Region: 299-581
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.32e-93
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000113
Further Details:      
 
Domain Number 2 Region: 583-690
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.42e-28
Family Anticodon-binding domain of Class II aaRS 0.0014
Further Details:      
 
Domain Number 3 Region: 128-168
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.000000000419
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0055
Further Details:      
 
Domain Number 4 Region: 257-298
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.000000436
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005108   Gene: ENSMICG00000005593   Transcript: ENSMICT00000005601
Sequence length 700
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1229:57937:80190:1 gene:ENSMICG00000005593 transcript:ENSMICT00000005601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNAGEEKRKEGGKKKSKEVSGDGGRAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSWKPYQICIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVYWHSSAHIMGEAMERVYGGCLCYGPPIENGFYYDMYLEEGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNSSTYWEGKADMETLQRIYGISFPDPKMLKEWEKFQEEAKNRDH
RKIGRDQELYFFHELSPGSCFFLPKGAYIYNTLIEFIRSEYRKRGFQEVVTPNIYNSRLW
MTSGHWQHYSENMFSFEVEKELFALKPMNCPGHCLMFDHRPRSWRELPLRMADFGVLHRN
ELSGALTGLTRVRRFQQDDAHIFCAMEQIEDEIKGCLDFLRTVYSVFGFSFKLNLSTRPE
KFLGDIEVWNQAERQLENSLNEFGEKWELNPGDGAFYGPKIDIQIKDAIGRYHQCATIQL
DFQLPIRFNLTFVSHDGDDKKRPVIVHRAILGSVERMIAILTENYGGKWPFWLSPRQVMV
VPVGPTCDEYAQKVRQQFHDAKFMADIDLDPGCTLNKKIRNAQLAQYNFILVVGEKEKNS
GTVNIRTRDNKVHGERTISETIERLQQLKQSRSKQAEEEF
Download sequence
Identical sequences ENSMICP00000005108 ENSMICP00000005108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]