SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005169 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005169
Domain Number 1 Region: 61-246
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000000451
Family Brix domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005169   Gene: ENSMICG00000005672   Transcript: ENSMICT00000005667
Sequence length 353
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1229:995887:1004151:1 gene:ENSMICG00000005672 transcript:ENSMICT00000005667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATKRKRRGSLAVQAKKPKRNEDVAGPPAKRHVIAEEVEEEDRDRIPGPVCKGKWTNKE
RILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEA
KKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPALDGLPHYAX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIIEEDAALVEIGPRFVLNL
IKIFQGSFGGPTLYENPHYQSPNMHRRIIRSMTAAKYKEKQQVKEVQKLRKKEQKTLVPH
DPTADVFVIPAEEKPIEIQWVKPEPKVDLKARKKRIYKRQRKMKQKMGSGKTK
Download sequence
Identical sequences ENSMICP00000005169 ENSMICP00000005169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]