SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005187 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005187
Domain Number 1 Region: 545-715
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-43
Family p120GAP domain-like 0.00047
Further Details:      
 
Domain Number 2 Region: 397-495
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-22
Family p120GAP domain-like 0.0065
Further Details:      
 
Domain Number 3 Region: 247-357
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000122
Family Synaptotagmin-like (S variant) 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005187
Domain Number - Region: 1162-1237
Classification Level Classification E-value
Superfamily Tropomyosin 0.085
Family Tropomyosin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005187   Gene: ENSMICG00000005678   Transcript: ENSMICT00000005685
Sequence length 1328
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4619:55293:97234:1 gene:ENSMICG00000005678 transcript:ENSMICT00000005685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYAPFRDVRGPPMHRTQYVHSPYDRPGWNPRFCIISGNQLLMLDEDEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRPHGEHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD
NSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFWGEHFEFN
NLPAVRALRLHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSG
GMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVL
EPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIE
EYMRLIGQKYLKDAIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYP
DEQTSRTLTLIAKVIQNLANFSKFTSKEDFLGFMNEFLELEWGSMQQFLYEISNLDTLTN
SSSFEGYIDLGRELSTLHALLWEVLPQLSKEALLKLGPLPRLLNDISTALRNPNIQRQPS
RQSERPRPQPVVLRGPSAEMQGYMMRDLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSQTPSTLNPTMPASERTV
AWVSNMPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRK
LEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQXXXXXXXXXXXXXLMLVEEELRR
DHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENG
EFRNTADH
Download sequence
Identical sequences ENSMICP00000005187 ENSMICP00000005187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]