SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005242 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005242
Domain Number 1 Region: 24-462
Classification Level Classification E-value
Superfamily Sema domain 5.49e-110
Family Sema domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1315-1444
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-16
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 478-521
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000349
Family Plexin repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 894-942
Classification Level Classification E-value
Superfamily E set domains 0.0000000202
Family Other IPT/TIG domains 0.056
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005242
Domain Number - Region: 1734-1807
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0432
Family p120GAP domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005242   Gene: ENSMICG00000005737   Transcript: ENSMICT00000005745
Sequence length 1840
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4381:9765:30088:-1 gene:ENSMICG00000005737 transcript:ENSMICT00000005745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLLWALTLLGLAGVGSGLRPRKLESFRSETELNHLVVDGASGVVYLGAVNALYQLSAD
LQLEQRAATGPAPDNKKCTPPIEASQCHEAMLTDNVNQLLLLDPPRRRLVECGSLFKGIC
ALRSLSNISTRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGERVLFVGKGNGPHDNG
VIVSTRLLDRADGREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPA
QNRTLLARMCKQDPYYYSYLEMDLQCRDPGDAQAPAFGLCLAASVAAPGAGRVLYAAFSR
DGRGGGGPGSGLCLSLLEEVHAKMEANRNACYTGTREAARDTFYKPFHGEIQCGGHVLGA
SQSFPCGSEHLPYPLGSRDGLTATAVLQRGGLNLTAVTVTAENGHTIAFLGTSDGRILKV
YLAPDGTSSEYGSILVEINKRIKQDLVLSGDLASLYAMTQDKXXXXXXXXXXXXXXXXQC
RDSQDPYCGWCVVEGRCTRRAECPRAEEPSHWLWSRNRSCVVVTGAEPQNMSRRAQGEVQ
LAVSPLPALGEDDALLCLFGDSAPHAARVEGDAVVCNSPSSIPGTPPGQXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXAMSLVENLPCISCASNRWTCQWDLRYHECREASPNPEDGIV
RAHTEDSCPQFLNPSPVVIPMNHETEVTFQGRNLETVKGSSLHAGSDLLKFEEPVRMQES
GTFVFRTPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSPDSVQFTFQQPEPL
SVEPRQGPKPGGTTLTINGTHLDTGSKEDVRVTLNGVLCKVXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
MKTLSETDLLLEPPEVQPPPKRRQNRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPL
SLILPLVIVPMVAVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMI
EMEDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPASRRPVVEQALYQ
FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELME
QYVVAKNPKLMLRRSETVVERMLSNWMSICLYQHLKDSAGEPLYKLFKAIKHQVEKGPVD
AVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKVIDQV
YRTQPCSCWPKPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLIL
SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPADEVDEGKSKRGSVKEKERTKAIT
EIYLTRLLSVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSPSNK
LLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYT
QKYYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences ENSMICP00000005242 ENSMICP00000005242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]