SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005382 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005382
Domain Number 1 Region: 22-296
Classification Level Classification E-value
Superfamily DNase I-like 3.14e-32
Family DNase I-like 0.000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005382   Gene: ENSMICG00000005898   Transcript: ENSMICT00000005898
Sequence length 299
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_282:212272:214050:1 gene:ENSMICG00000005898 transcript:ENSMICT00000005898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGTRVLLTALWALGAAGATALRIGAFNIQSFSDNKVSDSACGSVIAQILAGYDITLVQE
VRDPDLSAVSMLMEQINSVSEHEYSFVSSEPLGRDQYKEMYLFVYRKDKVSVVDTYQYPD
PEDAFSREPFVVKFSAPGSGEPAPPLPSRRALTLALPAAIRELVLIPLHSAPRHAVAEID
ALYVYLDVIDKWGTDDMLFLGDFNADCKYVRPHDWAAIRLRSSEVFKWLIPDSADTTVGN
SDCAYDRIVVCGAQLRRSLKPQSAVVRDFQEEFGLDQTQARALAISDHFPVEVTLKSHQ
Download sequence
Identical sequences ENSMICP00000005382 ENSMICP00000005382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]