SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005400 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005400
Domain Number 1 Region: 249-442
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 6-157
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.02e-37
Family BAR domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005400   Gene: ENSMICG00000005910   Transcript: ENSMICT00000005917
Sequence length 879
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2884:50215:130597:-1 gene:ENSMICG00000005910 transcript:ENSMICT00000005917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDMVRSMCHHSHKRLMACFQGQHGT
DADRRHKKLPLTALAQNLQEASTQLEESLLGKMLETCGDAENQLALELSQHEVLVEKEIV
DPLYSIAEVEIPNIQKQRKQLAKLVLDWDSVRARWNQAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLK
AALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDL
WRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWAKNEGTLAEMA
AATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPNSNHSSHTGNDSDSGTLERK
RPASMAVMEGDLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTLAPAGP
EPPPQSSRAESSSGGGTVPSSAGMLEQGPSPSDGSPPKPKDSAAAAPPTPAPGRNSSQVT
TGQTQTQAAASSHQLSAGPAHNAAGPSPHTLRRAVKKPAPAPPKPGNPPPGHLGGQSSPG
TSQQPPSLSPKPSTRSPSPPTQHPGQPSAPSQLSAPRRYSSSLSPIQAPSHPPPQPPTQA
TPLMHTKPSSQGPATPMALPSEHGLEQPPHTPPQTPTPPSTPPLGKQNPGLPASQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPGAHAAGDGNLTNTAPTASKIVTDTNS
RVPEPLRSIFPEVPSDSASKDLPGRILLDIDNDTESTAL
Download sequence
Identical sequences ENSMICP00000005400 ENSMICP00000005400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]