SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005426 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005426
Domain Number 1 Region: 542-754
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.69e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000905
Further Details:      
 
Domain Number 2 Region: 490-538
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000454
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 3 Region: 91-167
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000371
Family FCH domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005426   Gene: ENSMICG00000005944   Transcript: ENSMICT00000005949
Sequence length 958
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_966:79596:101707:-1 gene:ENSMICG00000005944 transcript:ENSMICT00000005949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAAEPLPPAPEGRKRYSDIFRSLDNLEISLGNVTLEMLAGDPVLPGDPEPNKAPLAAVN
SEASCWSSPCPEGPAPLTGEELDLRLIRTKGGVDAALEYAKTWTRYAKELLAWTEKRANY
ELEFAKSTMKIAEAGKVSIHQQSHMPLQYIYTLFLEHDLNLGALAMETVAQQKRDYYQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXQLRRAQAERGPRAFAALAECCEPFEPGQRYQEFVRAVQPEPPPPPP
PAFSFQEFIPSAHSSPLDTRKKLSGPPPPRLDESSAEPGTWEDSGTSWQGTPGPTPGSDV
DSVGGGSESRSMDSPTSSPGPDTRRLVKVSSIGTESSDDFEERDPDLGDGLENGLGSPLK
KWTLSSAAQTHRLRRLRGPAKCRECEAFMVSGIECEECFLTCHKRCLETLLILCGHKRLP
ARTPLFGVDFLQVPRDFPEEVPFVVTRCTAEIEHRALGVQGIYRVSGSRVRVERLCQAFE
NGRALVELSGNSPHDVSSVLKRFLQELTDPVIPFHLYDAFISLAKTLHADPGDNPGTPSP
SPEVIRSLKTLLVQLPDSNYNTLRHLVAHLFRVAAQFEENKMSANNLGIVFGPTLLRSPD
GPWAAGSIPVTCLLDSGHQAQLVEFLIVHYEQIFGMDELPLATEPPPRDSSPQLLLPHLG
PEPQPPALALDPDPDPKPQIALEKHAEATPPEIPTPQGDQREEEAEDTKDGEGEAFSQGP
EDLLLGTQSRGHFSRQPVKYPRGGMRPVTHQLSSLALVAFKLCEETPVTSVPRGSLRGRG
PGPAATSREGSPLRRAPLPKHFEITQETARLLSKLDSEAVPKATCFPEPQPEEAEDHL
Download sequence
Identical sequences ENSMICP00000005426 ENSMICP00000005426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]