SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005458 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005458
Domain Number 1 Region: 308-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-18
Family Pentraxin (pentaxin) 0.096
Further Details:      
 
Domain Number 2 Region: 1522-1596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000653
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 687-763,796-814
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000734
Family Zinc protease 0.085
Further Details:      
 
Domain Number 4 Region: 535-631,719-773
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000151
Family Zinc protease 0.079
Further Details:      
 
Domain Number 5 Region: 1466-1528
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.007
Further Details:      
 
Domain Number 6 Region: 1588-1645
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000222
Family Complement control module/SCR domain 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005458
Domain Number - Region: 1045-1105
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00255
Family Fibronectin type III 0.0079
Further Details:      
 
Domain Number - Region: 1726-1756
Classification Level Classification E-value
Superfamily Notch domain 0.0235
Family Notch domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005458   Gene: ENSMICG00000005975   Transcript: ENSMICT00000005985
Sequence length 1789
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1328:76451:314711:1 gene:ENSMICG00000005975 transcript:ENSMICT00000005985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRLRVLRISLVILAGWACSTANSELGWTRKKSLAQRGHLNQVLLEGEHCWLGARARRPR
AAPQHHLFGVYPSRPGDYLRPYPVGEQGIRPAGRSEPDTGGKAVSLVPQDWMGNTAGARS
GAEPPVAPWLGDGPMGQSEPLGDDDTYVGYQRSKESLGETGTRKSCSTAAITTGFSSLKE
LXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVFDNCSHTVSDKGWALGIRSGTDKGRRDARFFFSLRTDRMKKATVVVSHRRYQPG
VWTHVAATYDGRRMALYVDGTQVASSPDQSGPLNSPFMASCRSLLLGGDSSERGHHFRGH
VGTLAVWSAALPQGHLQHSPQRADGAEQLSALVLAASFEPLEEQWAPFREGTFPRLEVLQ
GSGPEPEVLSPLQPPPCGQTACDNVELISQYNGHWPLRGEKVLRYQVVNVCDDEGRDPTV
SEEQVRRQHAALNEAFARYNISWRLSVRRVHNSTLRRRVVLVNCEPGKVGNDHCDPECEH
PLTGYDGGDCRLQGRCYSWNRRDGVCHAECNNMLNDFDDGDCCDPAVADVRKTCFDPDSP
RRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAISHLGGVVLNPAYY
GMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETAPSMETGDLCADTAPTPKSKL
CGDPEPTNDTCGFVHFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSESRK
PTPIPIPPMVIGQTRRSLTIHWLPPISGVVYDXALSSVCGACTEDGTFRQYVHTASSRRV
CDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPTEGCSLELLFQHPVR
ADTLTLWVTYLSMDSSQALFDTEILLEHQESVHLGPLDTFCDTPLTIKLHVDGKVSGVKV
YTFDERMEIDAALLTSRPRSALCAGCRPVGYRVLREPPFPSGAAVAVTHPRRRFTDEEVT
PGQMYRYQVQVEAGTELGEASPPLNHIHGAPYCGDGKVAGSLGEECDDGDLLSGDGCSRA
CELEEGFKCVGEPSLCYLYEGDGVCEPFERDTSIVDCGLHTPKGLLDLWATQAYSSNEDK
RKCPVSLVTGEPHSMVCTPYHPDLPRHHPLTGWFPCVTSGNRAQEEESEQPEGGLQKEDE
VWLKVCFNRPGVASAILIFLTTDGLVPGKHQKPTVTLHMTDVSGKNHSLGTYELSCQQNP
LIINVTHHPNILFHPTTSVLLKFSSPLVGISAVALRTPSHISPSAPDSCIPEHTRENHQE
HSCVHRPCGEQGSCVPLLLDHADVANCTSSGPGHMKCAITCQRGCALQTSSGQFLRPVQK
EILLTCSSGHWDRDVSCMPLDCGVPDPSLVNHATFSCSEGTGFLKRCSISCVPPAKLQGL
SPWLTCLEDGLWSLPDVYCKLECGVPPIIPNADLLLPHCLQGSHDVGTVCRYECKPGYYA
VESAESEVRNKFLKIQCLEGGVWEQGSCTPVVCEPPSPVFEGMYECTNGFNLDSQCVLNC
NKESEKLPILCTKEGLWTQEFKLCENLQGECPPPPSELNLVEYKCEQGYGIGAVCSPSCI
IPPSDPVTLPENTTVDTLEHWMKPVKVQNIVCTGRRQWHPDPVLVHCIQSCEPFQADGWC
DTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPTAEENQ
Download sequence
Identical sequences ENSMICP00000005458 ENSMICP00000005458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]