SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005512 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005512
Domain Number 1 Region: 141-250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-32
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 2 Region: 296-409
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-30
Family Spermadhesin, CUB domain 0.00077
Further Details:      
 
Domain Number 3 Region: 458-570
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 3.27e-28
Family Frizzled cysteine-rich domain 0.0003
Further Details:      
 
Domain Number 4 Region: 255-291
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005512
Domain Number - Region: 416-446
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005512   Gene: ENSMICG00000006043   Transcript: ENSMICT00000006045
Sequence length 573
Comment pep:novel scaffold:micMur1:scaffold_4829:8951:13613:-1 gene:ENSMICG00000006043 transcript:ENSMICT00000006045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDYSDVILCVEATGLSKTEFCNPAFEPESGLPCPPPAFQEDGSCSIRAPWHGRRPRVLQ
PDCHFSWLCVLLLASLLLLLLGLLVAVILAQLQAAPPPRPSYSPLPAQGLTTTGTTTTSQ
ATATPKRQQEAGMSPTVQSTCGGLLSGPRGFFSSPNYPDPYPINAHCVWHIQVATDHTIQ
LKIEALSMESVASCLFDRLEISPEPEGPLLRVCGRVPPPTLNTNASRLRVAFVSDSSVEG
FGFHAWYQAVAPGHGDCAHDEFPCDQLVCLLPDSVCDGFANCADGSDETNCSAKSSGCGG
NLTGLHGTFSNTNMQQPHQQLCTWHISVPAGYGIELQFHNFSLEAQDECKFDYVEVYETS
GSGALSLLGRFCGAEPPPPLISSHHELAVLLRTDHGISSGGFSATYWAFNATENPCGPRE
FCQDGGCKGLQWMCDLWRDCPDSSNDNCSSPLFPPPELACEPVQVEMCIGLSYNTTAFPN
IWVGMATQEEVVEVLSGYKSLTSLPCYQNFRRLLCGLLVPRCTPLGSVLPPCRSVCQEAE
HQCQSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences ENSMICP00000005512 ENSMICP00000005512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]