SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005618 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005618
Domain Number 1 Region: 555-691
Classification Level Classification E-value
Superfamily PH domain-like 1.9e-46
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000265
Family Synaptotagmin-like (S variant) 0.0072
Further Details:      
 
Domain Number 3 Region: 482-584
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000487
Family p120GAP domain-like 0.0078
Further Details:      
 
Domain Number 4 Region: 342-381
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000294
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 5 Region: 159-186
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000249
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005618   Gene: ENSMICG00000006158   Transcript: ENSMICT00000006165
Sequence length 726
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4174:539:28206:-1 gene:ENSMICG00000006158 transcript:ENSMICT00000006165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNLPSYPGPNKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEIPRSFRHLSFYLF
DRDVFRRDSIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGQVHLELRLSEVITDSG
VVCHKLATRXXXXXXXXXXXXXXXXXXXXXXXXXXXXWSKKTKVKKKTNNPQFDEVFYFE
VTRPCSYSKKSHFDFEECKKSELDVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPNTIFRGNSLTSKCIDE
TMKLAGMHYLHVTLGPAIEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXDPQTSRTLTLVSKTIQTLGSLSKSKSASFKESYMATFYEFFNEQKYADAVKNFLDLIS
SSGRRDPKSVEQPILLKEGFMIKRAQGRKRFGMKNFKKRWFRLTNHEFTYQKSKGDPPLC
SIPIENILAVERLEEESFKMKNMFQVVQPERALYIQANNCVEAKDWIDILTKVSQCNQKR
LSVFHPSAYLNGHWLCCRASSDTAAGCTPCTGGLPANIQLDVDGDRETERIYSLFLTYMA
KLEKMQ
Download sequence
Identical sequences ENSMICP00000005618 ENSMICP00000005618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]