SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005672 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005672
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 5.48e-28
Family MHC antigen-recognition domain 0.00000995
Further Details:      
 
Domain Number 2 Region: 82-175
Classification Level Classification E-value
Superfamily Immunoglobulin 8.72e-23
Family C1 set domains (antibody constant domain-like) 0.0000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005672   Gene: ENSMICG00000006228   Transcript: ENSMICT00000006221
Sequence length 175
Comment pep:known_by_projection scaffold:micMur1:scaffold_27154:8671:9668:1 gene:ENSMICG00000006228 transcript:ENSMICT00000006221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EHVIIQAEFYLGPDQSGEFMFDFDGDEIFHVDMDKRETVWRLEEFGRFASFEAQGALANI
AVDKANLDIMMKRSNHTPNTNVPPEVTVLTNAPVELGEPNVLICFIDKFSPPVAKVTWLQ
NGKPVTTGVSETVFLPREDHLFRKFHYLPFLPSTEDFYDCKVEHLGLDEPLIKHW
Download sequence
Identical sequences ENSMICP00000005672 ENSMICP00000005672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]