SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005687 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005687
Domain Number 1 Region: 909-1101
Classification Level Classification E-value
Superfamily Bet v1-like 7.69e-61
Family STAR domain 0.00000000894
Further Details:      
 
Domain Number 2 Region: 48-122
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.2e-32
Family Variant SAM domain 0.0000424
Further Details:      
 
Domain Number 3 Region: 763-871
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000131
Family BCR-homology GTPase activation domain (BH-domain) 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005687
Domain Number - Region: 660-694
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0255
Family BCR-homology GTPase activation domain (BH-domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005687   Gene: ENSMICG00000006239   Transcript: ENSMICT00000006236
Sequence length 1113
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1870:298039:463456:-1 gene:ENSMICG00000006239 transcript:ENSMICT00000006236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRQVPRTPASGCYYLNSMTPEGQEMYLRFDQTARRSPYRMSRILARHQLVTKIQQEIEA
KEACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLYRRLNTLNKCASMK
LDVNFQRKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLHTLFPGGDRNGSPAGTGMRNT
TSSESVLTDLSEPEVCSIHSESSGGSDGRSQSGQLCTDSPVMLDAPPASSGLPPSPRDVL
HHPFHPKNEKPTRTRAKSFLKRMETLRAKGAHGRHKGSGRTGGLVISGPVLQQEPESFKA
MQCIQIPNGDLQNSPPAACKKGLPCSGKSSGESSSSEHSSSGVSTPCLKERKCHEASKRG
GMYLEDLDVLAGPALRDAGDQSHRHEFHSQENLLVHIPKDHKPGTFPKALSIESLSPTDN
SNGVNWRTGSISLGRQQGPGAREPRLPASCHRASRVSIYDNVPGSHLYASTGDLLDLEKD
DLFPHLDDILQHVNGLQEVVDDWSKNVLPELQTQDALAGEPGSSPFPSPNQITLDFEGNS
VSEGRTTPSDVERDGTSLNDAEAAGVRERRDSGVGASLTRPNRRLRWNSFQLSHQPRPAP
ASPHVSSQTAGQLNLLQRFSLLRLTAVMEKYSMSNKHGWTWSVPKFMKRMKVPDYRDKAV
FGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPKEQRLQAVQAAILLLAD
ENREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLKKESSPRVIQKKYATG
KPDQKDLNENLAAAQGLAHMIMECDRLFEVPHEMVAQSRSSYMEAEIHLPTLEDLGAQLE
ESGATFHTYLEHLIQGLQKEAREKFKGWVVCSSMDNTDLAFKKVGDGNPLKLWKASVEVE
APPSVVLNRVLRERHLWDEDFVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWRT
DLPKGMCALVSLSVEHEEAPLLGGVRAVVMESQHLIEPCGSGKSRLTHICRTDLKGRSPE
WYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI
Download sequence
Identical sequences ENSMICP00000005687 ENSMICP00000005687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]