SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005735 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005735
Domain Number 1 Region: 348-767
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.62e-108
Family Phosphofructokinase 0.00000703
Further Details:      
 
Domain Number 2 Region: 28-139,199-370
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.18e-75
Family Phosphofructokinase 0.0000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005735   Gene: ENSMICG00000006278   Transcript: ENSMICT00000006288
Sequence length 780
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_314:52468:141851:1 gene:ENSMICG00000006278 transcript:ENSMICT00000006288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGSARVITGSLRKFLEHLGAGKAIGVLSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYE
GYQGMVDGGTNIAEADWESVSSILQVGGTIIGSARCKDFLSREGRLKAAGNLVRLGITNL
CVIGGDGSLTGANIFRKEWRGLLQELAKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXHQRTFVLEVMGRHCGYLALVSALACGADWVFLPES
PPEENWEDHLCTKLSENRARKKRLNIIIVAEGAIDRKNKPITSEEVKQLVVKQLGYDTRV
TILGHVQRGGTPSAFDRILASRMGVAAVIALLEATPETPPCVVSLSGNHPVLLPLMECVQ
MTQDVQKAMDEGRFQDAVRLRGRSFEGNLKTYKSLAIKLPDDQIPKSNCNVAVINVGAPA
AGMNAAVRSAVRVGIANGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRV
LPGKNLGAIAEQMHNHNIHALLMIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNN
VPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADA
AYIFEEPFDIRDLQANVEHLTEKMKTTIQRGLVLRNESCSENYTTDFICQLYSEEGKGVF
DCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITEKLKEFKGKRFVTDDSICVLGISK
RNVLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKTSYDVSDAGEMEQVQPAAI
Download sequence
Identical sequences ENSMICP00000005735 ENSMICP00000005735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]