SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005769 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005769
Domain Number 1 Region: 233-319
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 0.00000968
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000005769
Domain Number - Region: 96-130
Classification Level Classification E-value
Superfamily TGS-like 0.0173
Family TGS domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005769   Gene: ENSMICG00000006324   Transcript: ENSMICT00000006324
Sequence length 351
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2743:5724:43057:-1 gene:ENSMICG00000006324 transcript:ENSMICT00000006324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMALGVRGLRLWRVAPGGRTGWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSEWYCKKSILALVDGQPWDMYKPLT
KSCEIKFLTFKDDDPGEVNKAYWRSCAMMMGCVIERAFKDEYVVSLVRAPEVPXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKIDFI
EEKASQNPERIVKLHRIGDFIDVSEGPLIPRTSICFQYEVSAVHNLQPTVPSLIRRFQGL
SLPIHLRAHFTIWDKLLERSRKMTPFPLLFTSYSFFISLPGSHILHGTVSE
Download sequence
Identical sequences ENSMICP00000005769 ENSMICP00000005769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]