SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000005829 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000005829
Domain Number 1 Region: 37-122
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-20
Family SH2 domain 0.00000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000005829   Gene: ENSMICG00000006388   Transcript: ENSMICT00000006387
Sequence length 122
Comment pep:novel scaffold:micMur1:scaffold_66542:4:369:-1 gene:ENSMICG00000006388 transcript:ENSMICT00000006387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQRCLESSGHGADGTRSPWGAAEAAEEPSPEAARLAKALRELRETGWYWGSMTVQEAKE
KLREAPEGTFLIRDSSHSDYLLTISVQTSVGPTNLRIEYQDGKFRLDSVPSVRPRLKQFD
SV
Download sequence
Identical sequences ENSMICP00000005829 ENSMICP00000005829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]