SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006202 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006202
Domain Number 1 Region: 650-843
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000379
Further Details:      
 
Domain Number 2 Region: 12-92
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000476
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 363-391
Classification Level Classification E-value
Superfamily WW domain 0.0000274
Family WW domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006202
Domain Number - Region: 483-577
Classification Level Classification E-value
Superfamily PH domain-like 0.00089
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006202   Gene: ENSMICG00000006800   Transcript: ENSMICT00000006807
Sequence length 845
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3233:12014:80205:-1 gene:ENSMICG00000006800 transcript:ENSMICT00000006807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKMADRSGRIVPGQVYIEVEYDYEYEAKDRKIVIKQGERYILVKKTNDDWWQVKPDENSK
AFYVPAQYVKEVTRKALMPPAKPAAGLPNNSVKVVQSLHLQRSTENVNKLPELSSFGKPS
SSVQGTGLIRDANQNFGPSYNPGQTLNLSLDLTHNNGKFNNDSHSPKVSSQNRTRLFGHF
LGPEFLDIEKTSFSQEQSCDSAGEGSERIHQDSESGDELSSSSTEQIRXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXWLKHVDDQGRQYYYSADGSRSEWELPKYNASSQQQREIIKSRSLDRRLQEPIVLTKW
RHSTIVLDTNDKESPTASKPCFPENESSPSSSKHQDTASSAQXXXXXXXXXXXXXXXXXX
XXXKNWLSSWAVLQGSSLLFTKTQGSSTSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLKTRQGTELLIQSDNDTVINDWFKVLSSTISNQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXMKVSSIDSSEQKKTKKNLKKFLTRRPTLQVREKGYXXXQVFGSNLASL
CQRENSTVPKFVKLCIEHVEEHGLDVDGIYRVSGNLAVIQKLRFAVNHDEKLDLNDSKWE
DIHVITGALKMFFRELPEPLFTFNHFNDFVNAIKQEPRQRVAAVKDLIRQLPKPNQDTMQ
VLFRHLKRVIENGEKNRMTYQSIAIVFGPTLLKPEKETGNIAVHTVYQNQIVELILLELS
SIFGR
Download sequence
Identical sequences ENSMICP00000006202 ENSMICP00000006202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]