SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006236 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006236
Domain Number 1 Region: 522-554,658-733
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000565
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006236   Gene: ENSMICG00000006832   Transcript: ENSMICT00000006843
Sequence length 886
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4543:152189:170958:-1 gene:ENSMICG00000006832 transcript:ENSMICT00000006843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKVKATVFGLLPXXX
XXXXXXXXXXXXXDLLGGLSGGSIQVPQGMAFALLANLPAVNGLYSSFFPLLTYFFLGGI
HQMVPGTFAVISILVGNICLQLAPESKFQVFNNVTNESHVDTAAMEAERLHVSATLACLT
AIIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTVPSYTGPGSIVFT
FIDICKNLPHTNIASLIFALISGALLVVVKELNARYMHRIRFPIPTEMIVVVVATAISGG
CKLPKKYHMQIVGEIQHGFPTPVSPVVSQWKDMVGTAFSLAIVGYVINLAVGRTLASKHG
YDVDSNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDGAGGKSQVASLCVSLVVMITML
VLGTYLYPLPKSVLGALIAVNLKNSLKQLADPYYLWRKSKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGYALARVADTDIYVNPKTYNRVQEIQGIKIVTYCSPLYF
ANSEIFRQKVIAKTGTDPQKVLLAKQKYLKKQEKRRAMPTQQRKSLFMKTKTVSLQELQQ
DFENPSPTDPNNNQTPANGASMSYISLSPDTSSAAPCEPPASAEPPGEPSDTLATVPPFV
TFHTLILDMSGVSFVDLMGIKALAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGS
LECGHVFPSIHDAVLFAQANAGEVAPGRTFQGAPGDPEPSLYDSEEDSPSYWDLEQEMFG
SMFHAETLTALESFSAAGKAYSSYRSESLTLPFTLQAPAARDKPPAHPPPPAHALVAADG
HLGFLTYRVSQEQKGTHNCADLVCKLQKVSSLHGLVSDGVRLSRTQ
Download sequence
Identical sequences ENSMICP00000006236 ENSMICP00000006236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]