SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006263 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006263
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-18
Family Dual specificity phosphatase-like 0.036
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000006263
Domain Number - Region: 523-599
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0903
Family BCR-homology GTPase activation domain (BH-domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006263   Gene: ENSMICG00000006876   Transcript: ENSMICT00000006874
Sequence length 666
Comment pep:known_by_projection scaffold:micMur1:scaffold_8853:41034:53942:1 gene:ENSMICG00000006876 transcript:ENSMICT00000006874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTDNILAMARPSSELLEKYHIIEQFHSHGIKTIINLQRPGEHASCGSPLEQESGFTYLPE
AFMEAGIYFYNFGWKDYGVASLTTILDMVKVMTFALQEGKLAVHCHAGLGRTXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLLDANRPVIKDVFEEPWSSAEIEKTVSEMV
TMQLDKELLRHDSDASDPFNPTAVVADFENQDVILSSEQEFDPLWKRRNVECLQPLTHLK
RCLSYSDSDLKRAESLLEQGETPGTVPAQVLLCHNPRQQKPISHCYVPQSLGLDLHKEAL
VRSTFSLWNQSKFGGLEGLKDNGSSLFHMSNIPKEAQQSRAFSEGVSGSHSPVEPVSPNF
PNAHKDLNPSHQQVAHCRCETHGDWGPGSVKEDSRTHRSPLDCGSSPKAQFSAGHETQDD
KDLSEAIPHSALLSGLSVEARRILAAKALANLNEFAEKEEVKRKVEMWQKELNSRDGAWE
RICGERDPFILCSLMWSWVEQLKEPVITKEDVDMLVDRQADAAEALFFLEKGQHQTILCV
LHCIVSLQTVPVDVEEAFLVHAIKAFTKVNFDSENGPVVYSTLKKIFKHILEEKRKMTKD
SPKPGL
Download sequence
Identical sequences ENSMICP00000006263 ENSMICP00000006263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]