SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006269 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006269
Domain Number 1 Region: 40-192
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.27e-45
Family Dual specificity phosphatase-like 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006269   Gene: ENSMICG00000006885   Transcript: ENSMICT00000006881
Sequence length 257
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1045:630252:637655:1 gene:ENSMICG00000006885 transcript:ENSMICT00000006881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYETFYSEYPECCIDVKPVSQEKIESERALISQRGKPMLNISYRPAYDQGGPVEILPFLY
LGSAYHASKCEFLANLHVTALLNVSQRTSEACTTHLHYKWIPVEDSHTADISSHFQEAID
FIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTRQFRLKDAFEYVKQRRSMISPNFGFM
GQLLQYESEILPSTPNPQPPSCQGEAAASSLIGHLQTLSPDVQGAYCTFPASVLAPVPSH
ATVSELCRNPVATATSC
Download sequence
Identical sequences ENSMICP00000006269 ENSMICP00000006269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]