SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006305 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000006305
Domain Number - Region: 61-166
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0255
Family Brix domain 0.028
Further Details:      
 
Domain Number - Region: 287-360
Classification Level Classification E-value
Superfamily FlgN-like 0.0458
Family FlgN-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006305   Gene: ENSMICG00000006915   Transcript: ENSMICT00000006920
Sequence length 462
Comment pep:novel genescaffold:micMur1:GeneScaffold_493:155268:159566:1 gene:ENSMICG00000006915 transcript:ENSMICT00000006920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSGRSRHQKRARAQAQLRNLEAYAAQPHSFVSTRGCRGNSIRQLSLNLRRVMKPLTAT
RLQIHKKNSLKDCIAVAGPLGVTHFLILSKTETNVYFKLMRLPGGPTLTFQVNKYTLVRD
VVSSLRRHRMHEQQFVHPPLLVLNSFGPHGMHVKLMATMFQNLFPSINVHKVNLNTIKRC
LLINYNPKSQELDFRHYSIKVVPVGASRGMKKLLQEKFPNMSRLQDISELLATGAGLSES
EAEPDGEHNITELPQAVAGRGNMQAQQSAVRLTEIGPRMTLQLIKIQDGIGEGKVMFHSF
VHKTEEELQAILAAKEHKLQLKAQRQAQQAENVRRKQEQREAHRKKSLEGMRKKRAKAEG
DSDAEDPGLPWRTASEEEEDEAEYFRQAVGEEPDEDMFPTVPKRRRPTWPGLHRGRDRGK
GRHSDRRLTHPKDRFQGAQTKLGSRGAARGRRRGSHGHKRVA
Download sequence
Identical sequences ENSMICP00000006305 ENSMICP00000006305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]