SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006344 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006344
Domain Number 1 Region: 43-197
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000118
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006344   Gene: ENSMICG00000006971   Transcript: ENSMICT00000006965
Sequence length 296
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_418:533799:572159:-1 gene:ENSMICG00000006971 transcript:ENSMICT00000006965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKTSPPLLGCNKPHLEKLTLGVTRILESSPGVTEVTILEKVPAERHMISSWEQKNNCMM
PEDLKNFYLMTNGFHMTWNVKLDDHTIPLGIMAINSISKLTQLNQSSMYSLPNAPTLADL
EXXXXXXGEDQPEKPHFDSRSVIFELDSCSGNGKVCLVYKTGKPALAQDTEIWFLDRALY
WHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPITYNTNLLTEETDS
FVNKLDPSKVFKSKNKILIPKKKGPVQPVGGQKGLSGPPAPSTSKSSSGSGNPVRK
Download sequence
Identical sequences ENSMICP00000006344 ENSMICP00000006344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]