SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006361 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006361
Domain Number 1 Region: 948-1075,1107-1313
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-79
Family p120GAP domain-like 0.00019
Further Details:      
 
Domain Number 2 Region: 17-181
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-39
Family Calponin-homology domain, CH-domain 0.0000164
Further Details:      
 
Domain Number 3 Region: 1538-1635
Classification Level Classification E-value
Superfamily RGC domain-like 7.32e-33
Family RGC domain 0.00000176
Further Details:      
 
Domain Number 4 Region: 611-814
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000558
Family Motor proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006361   Gene: ENSMICG00000006970   Transcript: ENSMICT00000006985
Sequence length 1635
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4365:48951:154435:1 gene:ENSMICG00000006970 transcript:ENSMICT00000006985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLA
KLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWLNAMDDIGLPKIFYPETTDI
YDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEEEINNMKIELEKYGIQMPAF
SKIGGILANELSVDEAALHAAVIAINEAIDRRIPADTFTALKNPNAMLVNLDEPLASTYQ
DVLYQAKQDKMANANRTENAERERDVYEELLTQAEIQGNVNKVNTISALANIDLALEQGA
ALALFKALQSPALGLRGLQQQNSDWYFKQLLSDKQQKRQSGQADPLQKEELQAGVDAANG
AAQQYQRRLAAVAAINAAIQKGVAEKTVMELMNPEAQLPQVYPFAADLYQKELATLQQQS
PQHNLTHPELSVAVEMLSSVALINRALESGDMNTVWKQLSSSVTGLTNIEEENCQRYLDE
LMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQA
LQIPAAKLEGVLAEVAQHYQDTLIRAKREKQETQDESAVLWLDEIQGGVWQSNRDTQEAQ
RFALGVFAINEAVESGDVGKTLGALRSPDVGLYGVIPECGDTYQSDLAEARKNKLAAGDN
NSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQL
WLANEGLITKLQACCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAY
LRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDIIKIQAFIRANKARDDYKTLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXDVVFHSKKLTKKNKEQLSDMMMINKQKGGLKASKEKREKLEAYQHLFYLLQTN
PTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIKSKVDQIQ
EIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQM
ESQTGEASKLPYDVTPEQALAHEEVKTRLDNSIRNMRAVTDKFLCAIISSVDKIPYGMRF
IAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQR
RNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKFRRFFQTACDVPELQDKFNVD
EYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIESLIG
ESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQPGE
TLTEILETPATNEQEAEHQRAMQRRAMRDAKTPDKMKKSKSVKEDSNLTLQEKKQKIHTG
LKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRRKAELVKXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIEDLQV
NQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRAKVN
VNLLIFLLNKKFYGK
Download sequence
Identical sequences ENSMICP00000006361 ENSMICP00000006361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]