SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006439 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006439
Domain Number 1 Region: 126-182
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000959
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000417
Family Complement control module/SCR domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006439   Gene: ENSMICG00000007073   Transcript: ENSMICT00000007069
Sequence length 182
Comment pep:novel genescaffold:micMur1:GeneScaffold_1922:678:7670:1 gene:ENSMICG00000007073 transcript:ENSMICT00000007069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLCNFPKINHGILYDEEKPLFPAYTGRFFYYSCEYNFASPSKSFWTRITCTEEGWSPTPR
CLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXSQGKCKTPPAIDNGDITSFPLQVYARGSSVEYQCQNLYALQGNKRITYRNGQWSEPPK
CL
Download sequence
Identical sequences ENSMICP00000006439 ENSMICP00000006439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]