SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006447 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006447
Domain Number 1 Region: 1215-1437
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-64
Family DBL homology domain (DH-domain) 0.00000000248
Further Details:      
 
Domain Number 2 Region: 1437-1577
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-32
Family Pleckstrin-homology domain (PH domain) 0.000000201
Further Details:      
 
Domain Number 3 Region: 208-308
Classification Level Classification E-value
Superfamily EF-hand 4.67e-30
Family Eps15 homology domain (EH domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 1136-1220
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-26
Family SH3-domain 0.0000608
Further Details:      
 
Domain Number 5 Region: 1591-1711
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.43e-26
Family PLC-like (P variant) 0.011
Further Details:      
 
Domain Number 6 Region: 7-105
Classification Level Classification E-value
Superfamily EF-hand 1.27e-25
Family Eps15 homology domain (EH domain) 0.0014
Further Details:      
 
Domain Number 7 Region: 910-972
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-19
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 8 Region: 1002-1057
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-18
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 9 Region: 735-814
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-18
Family SH3-domain 0.00021
Further Details:      
 
Domain Number 10 Region: 1071-1141
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-18
Family SH3-domain 0.0000746
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006447   Gene: ENSMICG00000007068   Transcript: ENSMICT00000007078
Sequence length 1718
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4717:4015:162516:1 gene:ENSMICG00000007068 transcript:ENSMICT00000007078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGIGGI
ASMPPLTAVAPVPMGSIPVVGMSPPLVSSVPTAAVPPLANGAPPVMQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASAPVAEWAVPQSSRLKYRQLFNSHDKTMSGHLT
GPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPP
EYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFERG
NLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELER
QREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEEDIVVLKAKKRLWEFEL
EAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESQQMLGRLI
PEKQILNDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLRDQLDEVEKETRSKLQEIDI
FNNQLKELREIHNKQQLQKQKSIEAERLKQKEQERKILLEKQKXXXXXRAQERDRPWLEH
VQQDEGHQRPRKLHDEERQKREESVKKKDSEEKGKQEVQDKLGRLFHPHQEPAKPAVQAP
WSTAEKGPLTISAQDNVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTGEPG
WLGGELKGKTGWFPANYAEKISENEVPAPVKPVTDLTSAPAPKLALRETPAPLAVTSSEP
STTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPGAGQLRQRSAFTPATATGSSP
SPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGWFPK
SYVKLISGPIRKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFIAMYTYESSEQGDLTF
QQGDVILVTKKDGDWWTGTVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIA
SYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKI
TPTEPPKSTALPAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQVGL
FPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIF
QKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQL
PHMQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVT
RYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCE
GLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDK
VFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWV
QKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEV
TMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVA
DIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP
Download sequence
Identical sequences ENSMICP00000006447 ENSMICP00000006447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]