SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006474 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006474
Domain Number 1 Region: 138-241
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.29e-46
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000289
Further Details:      
 
Domain Number 2 Region: 43-172
Classification Level Classification E-value
Superfamily Translation proteins 3.95e-36
Family Elongation factors 0.00000468
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006474   Gene: ENSMICG00000007114   Transcript: ENSMICT00000007108
Sequence length 262
Comment pep:novel scaffold:micMur1:scaffold_3628:217476:218264:1 gene:ENSMICG00000007114 transcript:ENSMICT00000007108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEPSANMPWFKGWKVTRKDGNASGTTLLEALDCILPPTRPTDKPLRLPLQDVYKIGGIG
TVPVGRVETGVLKPGMVVTFAPVNVTTEVKSVEMHHEALSEALPGDNVGFNVKNVSVKDV
RRGNVAGDSKNDPPMEAAGFTAQVIILNHPGQISAGYAPVLDCHTAHIACKFAELKEKID
RRSGKKLEDGPKFLKSGDAAIVDMVPGKPMCVESFSDYPPLGRFAVRDMRQTVAVGVIKA
VDKKAAGAGKVTKSAQKAQKAK
Download sequence
Identical sequences ENSMICP00000006474 ENSMICP00000006474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]