SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006544 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006544
Domain Number 1 Region: 69-145
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-16
Family BCR-homology GTPase activation domain (BH-domain) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006544   Gene: ENSMICG00000007183   Transcript: ENSMICT00000007181
Sequence length 381
Comment pep:novel genescaffold:micMur1:GeneScaffold_4878:7:5532:1 gene:ENSMICG00000007183 transcript:ENSMICT00000007181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRFFSRRREEPTLPREFTRRGRRGAISVDSLAELEDGALLLQTLQLSKVSFGVGRRLLGS
KRKMSLSPIAKQIPQVVEVCCDFIEEHGLHTVGLFSLEHSVQRVRKLREEFDKGVDVVLD
ENQNVHDVAALLEFFCDMKDSVLDDLYTSLTAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFEEPVEPPGTVCSRDYEEGTSQLPIPEQD
GPLFRVPREKAAKTSISYFFP
Download sequence
Identical sequences ENSMICP00000006544 ENSMICP00000006544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]