SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006607 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006607
Domain Number 1 Region: 5-65,108-326,438-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-42
Family FAD-linked reductases, N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 312-420
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.26e-21
Family L-aminoacid/polyamine oxidase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006607   Gene: ENSMICG00000007258   Transcript: ENSMICT00000007256
Sequence length 476
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2879:171472:175517:1 gene:ENSMICG00000007258 transcript:ENSMICT00000007256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRTVVVLGGGISGLAASYHLSRAPYPPKVVLVEGSERLGGWIRSVRGSDGAIFELGPRG
IRPAGALGARTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLLRPSP
PFSKPLFWAGLRDLTKPRGKEPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGMLLGAGQSPQLDSALIRQAQAERWSQWSLRGGLEMLPQAL
ETHLTSRGVIVLKGHPVSGLSLQAEGRWKVSLGDSSLEADHVISAIPASVLSKLLPAEAA
PLACALSAITAVSVAVVNLQYRGARLPVGFGHLVPSSEDPGILGIVYDSVAFPEQNGSSS
DLRVTVMMGGSWLQTLEASGCVLSQELFQHQAQKAAATQLGLKEPPSYCLVHLHKNCIPQ
YTLGHWQKLESARQFLAAQRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPQS
Download sequence
Identical sequences ENSMICP00000006607 ENSMICP00000006607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]